PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco006448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 438aa    MW: 46373.5 Da    PI: 6.0233
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco006448.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.31.1e-073864192154
                  HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  k +yp++e++++L +++gL+ +q+ +WF N+R +
  Aco006448.1 386 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 419
                  469*****************************87 PP

2ELK26.31.7e-09340361122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELKh+L+++Y+++L+++++E++
  Aco006448.1 340 ELKHELKQGYKEKLIDIREEIL 361
                  9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.0E-19171215IPR005540KNOX1
PfamPF037907.9E-18173214IPR005540KNOX1
SMARTSM012562.9E-28228283IPR005541KNOX2
PfamPF037911.2E-19233282IPR005541KNOX2
SMARTSM011880.004340361IPR005539ELK domain
PROSITE profilePS5121310.039340360IPR005539ELK domain
PROSITE profilePS5007111.742360423IPR001356Homeobox domain
SuperFamilySSF466895.56E-16362426IPR009057Homeodomain-like
SMARTSM003895.1E-11362427IPR001356Homeobox domain
CDDcd000862.80E-12363424No hitNo description
Gene3DG3DSA:1.10.10.605.1E-25367424IPR009057Homeodomain-like
PfamPF059201.2E-17380419IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MAYHGHGHHL SHEMGMATQY AEDNAAVLRT AAAAAAAAAA AAAEGGVGGG PAWLNSAILR  60
QQGAAQHGYV DGSFLHLQTS SDSSAAAPAP AAGGGAAVQW LPRPAILQRN GSGGGGGGGG  120
GSDVALPGET LMSASGISAD PGSSHGGGEE IGEGDAGEGT GGAGEGTWQS ARYKADILAH  180
PLYEQLLSAH VACLRIATPV DQLPRIDAQL AQSQHVVTKY SVLNGGGGAA HMPDDKELDQ  240
FMTHYVLLLC SFKEQLQQHV RVHAMEAVMA CWELEQSLQS LTGVSPGEGT GATMSDDDDE  300
DQANSEANLY DGLDGPDTLG FGPLVPTESE RSLMERVRQE LKHELKQGYK EKLIDIREEI  360
LRKRRAGKLP GDTTSTLKAW WQSHSKWPYP TEEDKARLVQ ETGLQLKQIN NWFINQRKRN  420
WHSNPSSSSV LKSKRKR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111121SGGGGGGGGGS
2416436RKRNWHSNPSSSSVLKSKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6671421e-125KM667142.1 Ananas bracteatus clone 52544c microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009408038.10.0PREDICTED: homeobox protein knotted-1-like 13
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM0TEV70.0M0TEV7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P05170_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-163KNOTTED1-like homeobox gene 3